PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr030135.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 327aa    MW: 36297.7 Da    PI: 7.4771
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr030135.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +l+ +++++G g+W++ +++ g++R++k+c++rw +yl
      Pbr030135.1 14 RGAWTPEEDRKLLAYIQLHGHGSWRSLSQKAGLKRCGKSCRLRWINYL 61
                     89********************************************97 PP

2Myb_DNA-binding48.91.5e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++  Ed+ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
      Pbr030135.1  67 RGNFSLYEDQTIIQLHALLGNR-WSAIATYLP-KRTDNEIKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.049961IPR017930Myb domain
SuperFamilySSF466893.13E-3011108IPR009057Homeodomain-like
SMARTSM007176.3E-151363IPR001005SANT/Myb domain
PfamPF002491.0E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-231568IPR009057Homeodomain-like
CDDcd001677.37E-121661No hitNo description
PROSITE profilePS5129424.53562116IPR017930Myb domain
SMARTSM007179.8E-1566114IPR001005SANT/Myb domain
PfamPF002491.2E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2569116IPR009057Homeodomain-like
CDDcd001677.48E-1174112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MRKSGSYAAS GIKRGAWTPE EDRKLLAYIQ LHGHGSWRSL SQKAGLKRCG KSCRLRWINY  60
LRPDIKRGNF SLYEDQTIIQ LHALLGNRWS AIATYLPKRT DNEIKNYWNT HLKKRLAKIG  120
LDPATHKPKA AILGSANGDP KNLSNLSHIA QWESARIQAE ARFVNESKPR MHASAPAASL  180
SDEHHQFAPP LVPQCLDILR ASAWESLISM SKSSSRSAAL IDDTNGQGNV SFGDHHHVHD  240
HGVNMDGQDY GPNFEAPTYI PTSDQQLSSL MGYDDATLMS VPTGSMDIYE LFGQYCGNEC  300
SESLAALHHN LGSEFEDAWN SLEQIM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-25141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009339144.10.0PREDICTED: myb-related protein Hv1-like
TrEMBLM5WDU61e-131M5WDU6_PRUPE; Uncharacterized protein (Fragment)
STRINGPOPTR_0010s17300.19e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-86myb domain protein 16